PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G120100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 606aa    MW: 66340.3 Da    PI: 5.1565
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G120100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2906.6e-892215992374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPil 91 
                          + L++cAeav++gd + a  lL+r++ ++sp+gd  qRla+yf+ +L+arla+ ++s+ly++l ++++s    ++ l a +l+   + ++
  Sevir.7G120100.1.p 221 HTMLMRCAEAVAAGDRNGAADLLERIRRHSSPAGDGAQRLAHYFAAGLEARLAGgTGSRLYRSLMVRRSS---LADYLRACQLYMAGCCFV 308
                         578***************************************************99*********99999...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          + +l   ++I +av+g +++Hi+ ++++ GlQWp  l+ L +R++gpp++R+Tg++sp +g   +e +eetg+rL++ A+++gvpf+f+ 
  Sevir.7G120100.1.p 309 PVIFLFSSETICRAVAGRKKLHIVSYGLGRGLQWPDVLRRLGNRDGGPPEVRLTGIDSPLPGfqPAELVEETGRRLSDCARRFGVPFRFRS 399
                         ***********************************************************999999999*********************** PP

                GRAS 181 lvakrledleleeLrvkpgEala.Vnlvlqlhrll......desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                          +a r ed+  + L+++p+E+l+ V + ++  +l+        ++  +++ d+vL+++++++P v++++  +a+++++ Fl+rf e l++ 
  Sevir.7G120100.1.p 400 -IAARSEDVVADGLDIDPDEVLVvVESTFHFRSLMdegvvvTVDGRNTNPMDTVLNTIREMRPSVFIHAVINASYSTAFFLTRFREVLYHS 489
                         .7999***************9761567777777774444433445556699**************************************** PP

                GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                         +alfd++++ lpr+++ r  +Er +l++ +vnv+aceg++r ++ +++++W++r ++aG++++pl+  +++  k  +++ + + +++ e++
  Sevir.7G120100.1.p 490 TALFDMMDTVLPRDDDRRLLLERDVLAQCAVNVIACEGEDRMHQPRSYKQWQARSRRAGLRQLPLDRGIVQMLKDKVKEEYHKCFEISEDQ 580
                         *********************************************************************************999******* PP

                GRAS 356 gslvlgWkdrpLvsvSaWr 374
                         ++l++gWk+r L+++S W+
  Sevir.7G120100.1.p 581 QWLLQGWKGRVLYALSTWT 599
                         ******************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.365194579IPR005202Transcription factor GRAS
PfamPF035142.3E-86221599IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MLMEDSIVDK FLCQYPDHPA LVQAQQLFSH ILSDASSSVL AEQPCNFAEL FSVQSSAPAP  60
AAAAVLSVAQ GSNIEDTAFF LNGMATDAVE SINSSLPAES TGCCMDVVSM AFFKGMEEAS  120
KFLPSDAMTA GGGGRGQKKR LDGDDDEAEL GSTMGRSSKQ MATAADGEES EEAAAREMLD  180
QLMLNGCGPS AADMQELRAA TTEMEKAPRG RRGTGAAVDL HTMLMRCAEA VAAGDRNGAA  240
DLLERIRRHS SPAGDGAQRL AHYFAAGLEA RLAGGTGSRL YRSLMVRRSS LADYLRACQL  300
YMAGCCFVPV IFLFSSETIC RAVAGRKKLH IVSYGLGRGL QWPDVLRRLG NRDGGPPEVR  360
LTGIDSPLPG FQPAELVEET GRRLSDCARR FGVPFRFRSI AARSEDVVAD GLDIDPDEVL  420
VVVESTFHFR SLMDEGVVVT VDGRNTNPMD TVLNTIREMR PSVFIHAVIN ASYSTAFFLT  480
RFREVLYHST ALFDMMDTVL PRDDDRRLLL ERDVLAQCAV NVIACEGEDR MHQPRSYKQW  540
QARSRRAGLR QLPLDRGIVQ MLKDKVKEEY HKCFEISEDQ QWLLQGWKGR VLYALSTWTA  600
GDDLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-342245988374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978027.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3Y5U30.0K3Y5U3_SETIT; Uncharacterized protein
STRINGSi009582m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-118GRAS family protein